SCOP 1.73: Domain d1it9h1: 1it9 H:1-121

Lineage for d1it9h1 (1it9 H:1-121)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (66 PDB entries)

8. Domain d1it9h1: 1it9 H:1-121 [76783]
   Other proteins in same PDB: d1it9h2, d1it9l1, d1it9l2
   part of humanized anti-human Fas Fab HFE7A

Details for d1it9h1

PDB Entry: 1it9, 2.8 Å

PDB Description: crystal structure of an antigen-binding fragment from a humanized version of the anti-human fas antibody hfe7a

PDB Compounds: (H:) humanized antibody hfe7a, heavy chain

SCOP Domain Sequences for d1it9h1:

Sequence; same for both SEQRES and ATOM records:

>d1it9h1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
qvqlvqsgaevkkpgasvkvsckasgytftsywmqwvkqapgqglewmgeidpsdsytny
nqkfkgkatltvdtststaymelsslrsedtavyycarnrdysnnwyfdvwgegtlvtvs
s

Timeline for d1it9h1:

• d1it9h1 first appeared in SCOP 1.63
  
• d1it9h1 appears in SCOP 1.71
  
• d1it9h1 appears in SCOP 1.75
  
• d1it9h1 appears in the current release, SCOPe 2.08