Lineage for d1it4a_ (1it4 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1750246Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1750247Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1750778Family a.133.1.3: Prokaryotic phospholipase A2 [63630] (1 protein)
    automatically mapped to Pfam PF09056
  6. 1750779Protein Prokaryotic phospholipase A2 [63631] (1 species)
  7. 1750780Species Streptomyces violaceoruber [TaxId:1935] [63632] (5 PDB entries)
  8. 1750785Domain d1it4a_: 1it4 A: [76781]
    complexed with ca

Details for d1it4a_

PDB Entry: 1it4 (more details)

PDB Description: solution structure of the prokaryotic phospholipase a2 from streptomyces violaceoruber
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1it4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it4a_ a.133.1.3 (A:) Prokaryotic phospholipase A2 {Streptomyces violaceoruber [TaxId: 1935]}
apadkpqvlasftqtsassqnawlaanrnqsawaayefdwstdlctqapdnpfgfpfnta
carhdfgyrnykaagsfdanksridsafyedmkrvctgytgekntacnstawtyyqavki
fg

SCOPe Domain Coordinates for d1it4a_:

Click to download the PDB-style file with coordinates for d1it4a_.
(The format of our PDB-style files is described here.)

Timeline for d1it4a_: