Lineage for d1is9a_ (1is9 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216372Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array
  4. 216373Superfamily a.102.1: Six-hairpin glycosyltransferases [48208] (5 families) (S)
  5. 216385Family a.102.1.2: Cellulases catalytic domain [48213] (6 proteins)
  6. 216386Protein CelA cellulase [48214] (1 species)
  7. 216387Species Clostridium thermocellum [TaxId:1515] [48215] (3 PDB entries)
  8. 216389Domain d1is9a_: 1is9 A: [76777]
    complexed with cl, hg

Details for d1is9a_

PDB Entry: 1is9 (more details), 1.03 Å

PDB Description: Endoglucanase A from Clostridium thermocellum at atomic resolution

SCOP Domain Sequences for d1is9a_:

Sequence, based on SEQRES records: (download)

>d1is9a_ a.102.1.2 (A:) CelA cellulase {Clostridium thermocellum}
agvpfntkypygptsiadnqsevtamlkaewedwkskritsngaggykrvqrdastnydt
vsegmgyglllavcfneqalfddlyryvkshfngnglmhwhidannnvtshdggdgaatd
adedialalifadkqwgssgainygqeartlinnlynhcvehgsyvlkpgdrwggssvtn
psyfapawykvyaqytgdtrwnqvadkcyqiveevkkynngtglvpdwctasgtpasgqs
ydykydatrygwrtavdyswfgdqrakancdmltkffardgakgivdgytiqgskisnnh
nasfigpvaaasmtgydlnfakelyretvavkdseyygyygnslrlltllyitgnfpnpl
sdl

Sequence, based on observed residues (ATOM records): (download)

>d1is9a_ a.102.1.2 (A:) CelA cellulase {Clostridium thermocellum}
agvpfntkypygptsiavtamlkaewedwkskritsngaggykrvqrdastnydtvsegm
gyglllavcfneqalfddlyryvkshfngnglmhwhidannnvtshdggdgaatdadedi
alalifadkqwgssgainygqeartlinnlynhcvehgsyvlkpgdrwggssvtnpsyfa
pawykvyaqytgdtrwnqvadkcyqiveevkkynngtglvpdwctasgtpasgqsydyky
datrygwrtavdyswfgdqrakancdmltkffardgakgivdgytiqgskisnnhnasfi
gpvaaasmtgydlnfakelyretvavkdseyygyygnslrlltllyitgnfpnplsdl

SCOP Domain Coordinates for d1is9a_:

Click to download the PDB-style file with coordinates for d1is9a_.
(The format of our PDB-style files is described here.)

Timeline for d1is9a_: