Lineage for d1is3a_ (1is3 A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 294476Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 294477Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 294847Family b.29.1.3: Galectin (animal S-lectin) [49932] (5 proteins)
  6. 294858Protein Congerin II [82034] (1 species)
  7. 294859Species Conger eel (Conger myriaster) [TaxId:7943] [82035] (4 PDB entries)
  8. 294860Domain d1is3a_: 1is3 A: [76773]
    complexed with lat, mes

Details for d1is3a_

PDB Entry: 1is3 (more details), 1.45 Å

PDB Description: lactose and mes-liganded congerin ii

SCOP Domain Sequences for d1is3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1is3a_ b.29.1.3 (A:) Congerin II {Conger eel (Conger myriaster)}
draevrnipfklgmyltvggvvnsnatrfsinvgestdsiamhmdhrfsygadqnvlvln
slvhnvgwqqeerskkfpftkgdhfqttitfdthtfyiqlsngetvefpnrnkdaafnli
ylagdarltfvrle

SCOP Domain Coordinates for d1is3a_:

Click to download the PDB-style file with coordinates for d1is3a_.
(The format of our PDB-style files is described here.)

Timeline for d1is3a_: