SCOP 1.75: Domain d1ireb_: 1ire B:

Lineage for d1ireb_ (1ire B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families)

5. Family b.34.4.4: Nitrile hydratase beta chain [50101] (2 proteins)
   contains irregular array of helices in the N-terminal extension

6. Protein Cobalt-containing nitrile hydratase [82067] (2 species)

7. Species Pseudonocardia thermophila [TaxId:1848] [82068] (5 PDB entries)
   Uniprot Q7SID3

8. Domain d1ireb_: 1ire B: [76770]
   Other proteins in same PDB: d1irea_
   complexed with cea, co, csd

Details for d1ireb_

PDB Entry: 1ire, 1.8 Å

PDB Description: Crystal Structure of Co-type nitrile hydratase from Pseudonocardia thermophila

PDB Compounds: (B:) nitrile hydratase

SCOP Domain Sequences for d1ireb_:

Sequence; same for both SEQRES and ATOM records:

>d1ireb_ b.34.4.4 (B:) Cobalt-containing nitrile hydratase {Pseudonocardia thermophila [TaxId: 1848]}
mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielvdt

Timeline for d1ireb_:

• d1ireb_ first appeared in SCOP 1.63
  
• d1ireb_ appears in SCOP 1.73
  
• d1ireb_ appears in SCOPe 2.01
  
• d1ireb_ appears in the current release, SCOPe 2.08