Lineage for d1ireb_ (1ire B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227526Fold b.34: SH3-like barrel [50036] (12 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 227819Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) (S)
  5. 227839Family b.34.4.4: Nitrile hydratase beta chain [50101] (2 proteins)
    contains irregular array of helices in the N-terminal extension
  6. 227840Protein Cobalt-containing nitrile hydratase [82067] (1 species)
  7. 227841Species Pseudonocardia thermophila [TaxId:1848] [82068] (1 PDB entry)
  8. 227842Domain d1ireb_: 1ire B: [76770]
    Other proteins in same PDB: d1irea_
    complexed with cea, co, csd

Details for d1ireb_

PDB Entry: 1ire (more details), 1.8 Å

PDB Description: Crystal Structure of Co-type nitrile hydratase from Pseudonocardia thermophila

SCOP Domain Sequences for d1ireb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ireb_ b.34.4.4 (B:) Cobalt-containing nitrile hydratase {Pseudonocardia thermophila}
mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielvdt

SCOP Domain Coordinates for d1ireb_:

Click to download the PDB-style file with coordinates for d1ireb_.
(The format of our PDB-style files is described here.)

Timeline for d1ireb_: