Class b: All beta proteins [48724] (119 folds) |
Fold b.34: SH3-like barrel [50036] (12 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) |
Family b.34.4.4: Nitrile hydratase beta chain [50101] (2 proteins) contains irregular array of helices in the N-terminal extension |
Protein Cobalt-containing nitrile hydratase [82067] (1 species) |
Species Pseudonocardia thermophila [TaxId:1848] [82068] (1 PDB entry) |
Domain d1ireb_: 1ire B: [76770] Other proteins in same PDB: d1irea_ complexed with cea, co, csd |
PDB Entry: 1ire (more details), 1.8 Å
SCOP Domain Sequences for d1ireb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ireb_ b.34.4.4 (B:) Cobalt-containing nitrile hydratase {Pseudonocardia thermophila} mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielvdt
Timeline for d1ireb_: