Lineage for d1iqya3 (1iqy A:97-211)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543045Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) (S)
  5. 2543046Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 2543047Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 2543048Species Arthrobacter globiformis [TaxId:1665] [54421] (40 PDB entries)
    Uniprot P46881 9-628
  8. 2543128Domain d1iqya3: 1iqy A:97-211 [76765]
    Other proteins in same PDB: d1iqya1, d1iqyb1
    complexed with ni

Details for d1iqya3

PDB Entry: 1iqy (more details), 1.8 Å

PDB Description: crystal structure of nickel-substituted amine oxidase from arthrobacter globiformis
PDB Compounds: (A:) amine oxidase

SCOPe Domain Sequences for d1iqya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqya3 d.17.2.1 (A:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

SCOPe Domain Coordinates for d1iqya3:

Click to download the PDB-style file with coordinates for d1iqya3.
(The format of our PDB-style files is described here.)

Timeline for d1iqya3: