Lineage for d1iqya1 (1iqy A:212-628)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782204Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1782205Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 1782206Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 1782207Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 1782208Species Arthrobacter globiformis [TaxId:1665] [50003] (40 PDB entries)
    Uniprot P46881 9-628
  8. 1782250Domain d1iqya1: 1iqy A:212-628 [76763]
    Other proteins in same PDB: d1iqya2, d1iqya3, d1iqyb2, d1iqyb3
    complexed with ni

Details for d1iqya1

PDB Entry: 1iqy (more details), 1.8 Å

PDB Description: crystal structure of nickel-substituted amine oxidase from arthrobacter globiformis
PDB Compounds: (A:) amine oxidase

SCOPe Domain Sequences for d1iqya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqya1 b.30.2.1 (A:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignydygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan

SCOPe Domain Coordinates for d1iqya1:

Click to download the PDB-style file with coordinates for d1iqya1.
(The format of our PDB-style files is described here.)

Timeline for d1iqya1: