Lineage for d1iqxb1 (1iqx B:212-628)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1534928Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1534929Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 1534930Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 1534931Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 1534932Species Arthrobacter globiformis [TaxId:1665] [50003] (40 PDB entries)
    Uniprot P46881 9-628
  8. 1534983Domain d1iqxb1: 1iqx B:212-628 [76760]
    Other proteins in same PDB: d1iqxa2, d1iqxa3, d1iqxb2, d1iqxb3
    complexed with co

Details for d1iqxb1

PDB Entry: 1iqx (more details), 2 Å

PDB Description: crystal structure of cobalt-substituted amine oxidase from arthrobacter globiformis
PDB Compounds: (B:) co(II)-substituted amine oxidase

SCOPe Domain Sequences for d1iqxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqxb1 b.30.2.1 (B:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignydygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan

SCOPe Domain Coordinates for d1iqxb1:

Click to download the PDB-style file with coordinates for d1iqxb1.
(The format of our PDB-style files is described here.)

Timeline for d1iqxb1: