Lineage for d1iqxa1 (1iqx A:212-628)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372004Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 372005Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
  5. 372006Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 372007Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 372008Species Arthrobacter globiformis [TaxId:1665] [50003] (12 PDB entries)
  8. 372019Domain d1iqxa1: 1iqx A:212-628 [76757]
    Other proteins in same PDB: d1iqxa2, d1iqxa3, d1iqxb2, d1iqxb3

Details for d1iqxa1

PDB Entry: 1iqx (more details), 2 Å

PDB Description: crystal structure of cobalt-substituted amine oxidase from arthrobacter globiformis

SCOP Domain Sequences for d1iqxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqxa1 b.30.2.1 (A:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignadygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan

SCOP Domain Coordinates for d1iqxa1:

Click to download the PDB-style file with coordinates for d1iqxa1.
(The format of our PDB-style files is described here.)

Timeline for d1iqxa1: