Lineage for d1iq6b_ (1iq6 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2187946Family d.38.1.4: MaoC-like [82636] (6 proteins)
  6. 2187947Protein (R)-specific enoyl-CoA hydratase [82637] (1 species)
    involved in polyhydroxyalkanoate (PHA) biosynthesis
  7. 2187948Species Aeromonas caviae [TaxId:648] [82638] (1 PDB entry)
  8. 2187950Domain d1iq6b_: 1iq6 B: [76756]
    complexed with ipa

Details for d1iq6b_

PDB Entry: 1iq6 (more details), 1.5 Å

PDB Description: (r)-hydratase from a. caviae involved in pha biosynthesis
PDB Compounds: (B:) (r)-specific enoyl-coa hydratase

SCOPe Domain Sequences for d1iq6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iq6b_ d.38.1.4 (B:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]}
saqslevgqkarlskrfgaaevaafaalsedfnplhldpafaattaferpivhgmllasl
fsgllgqqlpgkgsiylgqslsfklpvfvgdevtaevevtalredkpiatlttriftqgg
alavtgeavvklp

SCOPe Domain Coordinates for d1iq6b_:

Click to download the PDB-style file with coordinates for d1iq6b_.
(The format of our PDB-style files is described here.)

Timeline for d1iq6b_: