![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) ![]() |
![]() | Family d.38.1.4: MaoC-like [82636] (6 proteins) |
![]() | Protein (R)-specific enoyl-CoA hydratase [82637] (1 species) involved in polyhydroxyalkanoate (PHA) biosynthesis |
![]() | Species Aeromonas caviae [TaxId:648] [82638] (1 PDB entry) |
![]() | Domain d1iq6b_: 1iq6 B: [76756] complexed with ipa |
PDB Entry: 1iq6 (more details), 1.5 Å
SCOPe Domain Sequences for d1iq6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iq6b_ d.38.1.4 (B:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]} saqslevgqkarlskrfgaaevaafaalsedfnplhldpafaattaferpivhgmllasl fsgllgqqlpgkgsiylgqslsfklpvfvgdevtaevevtalredkpiatlttriftqgg alavtgeavvklp
Timeline for d1iq6b_: