SCOP 1.63: Domain d1iq6b_: 1iq6 B:

Lineage for d1iq6b_ (1iq6 B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (4 families)

5. Family d.38.1.4: MaoC dehydratase [82636] (1 protein)

6. Protein (R)-specific enoyl-CoA hydratase [82637] (1 species)
   involved in polyhydroxyalkanoate (PHA) biosynthesis

7. Species Aeromonas caviae [TaxId:648] [82638] (1 PDB entry)

8. Domain d1iq6b_: 1iq6 B: [76756]
   complexed with ioh

Details for d1iq6b_

PDB Entry: 1iq6, 1.5 Å

PDB Description: (r)-hydratase from a. caviae involved in pha biosynthesis

SCOP Domain Sequences for d1iq6b_:

Sequence; same for both SEQRES and ATOM records:

>d1iq6b_ d.38.1.4 (B:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae}
saqslevgqkarlskrfgaaevaafaalsedfnplhldpafaattaferpivhgmllasl
fsgllgqqlpgkgsiylgqslsfklpvfvgdevtaevevtalredkpiatlttriftqgg
alavtgeavvklp

Timeline for d1iq6b_:

• d1iq6b_ is new in SCOP 1.63
  
• d1iq6b_ appears in SCOP 1.65
  
• d1iq6b_ appears in the current release, SCOPe 2.08