Lineage for d1iq6a_ (1iq6 A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327792Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 327793Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (5 families) (S)
  5. 327821Family d.38.1.4: MaoC dehydratase [82636] (1 protein)
  6. 327822Protein (R)-specific enoyl-CoA hydratase [82637] (1 species)
    involved in polyhydroxyalkanoate (PHA) biosynthesis
  7. 327823Species Aeromonas caviae [TaxId:648] [82638] (1 PDB entry)
  8. 327824Domain d1iq6a_: 1iq6 A: [76755]

Details for d1iq6a_

PDB Entry: 1iq6 (more details), 1.5 Å

PDB Description: (r)-hydratase from a. caviae involved in pha biosynthesis

SCOP Domain Sequences for d1iq6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae}
aqslevgqkarlskrfgaaevaafaalsedfnplhldpafaattaferpivhgmllaslf
sgllgqqlpgkgsiylgqslsfklpvfvgdevtaevevtalredkpiatlttriftqgga
lavtgeavvklp

SCOP Domain Coordinates for d1iq6a_:

Click to download the PDB-style file with coordinates for d1iq6a_.
(The format of our PDB-style files is described here.)

Timeline for d1iq6a_: