Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (9 proteins) |
Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species) |
Species Streptomyces sp., R61 [TaxId:1931] [56605] (7 PDB entries) |
Domain d1ikia_: 1iki A: [76751] complexed with dal, rey |
PDB Entry: 1iki (more details), 1.25 Å
SCOP Domain Sequences for d1ikia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ikia_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., R61} lpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrvgs vtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmfaq tvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsvate yqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagavis stqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtgtv qgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp
Timeline for d1ikia_: