Lineage for d1ikia_ (1iki A:)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 266132Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 266133Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 266134Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (9 proteins)
  6. 266336Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species)
  7. 266345Species Streptomyces sp., R61 [TaxId:1931] [56605] (7 PDB entries)
  8. 266348Domain d1ikia_: 1iki A: [76751]
    complexed with dal, rey

Details for d1ikia_

PDB Entry: 1iki (more details), 1.25 Å

PDB Description: complex of streptomyces r61 dd-peptidase with the products of a specific peptidoglycan substrate fragment

SCOP Domain Sequences for d1ikia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ikia_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., R61}
lpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrvgs
vtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmfaq
tvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsvate
yqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagavis
stqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtgtv
qgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp

SCOP Domain Coordinates for d1ikia_:

Click to download the PDB-style file with coordinates for d1ikia_.
(The format of our PDB-style files is described here.)

Timeline for d1ikia_: