SCOPe 2.08: Domain d1ikia_: 1iki A:

Lineage for d1ikia_ (1iki A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species)

7. Species Streptomyces sp., R61 [TaxId:1931] [56605] (14 PDB entries)
   Uniprot P15555 34-378 ! Uniprot P15555

8. Domain d1ikia_: 1iki A: [76751]
   complexed with dal, rey

Details for d1ikia_

PDB Entry: 1iki, 1.25 Å

PDB Description: complex of streptomyces r61 dd-peptidase with the products of a specific peptidoglycan substrate fragment

PDB Compounds: (A:) d-alanyl-d-alanine carboxypeptidase

SCOPe Domain Sequences for d1ikia_:

Sequence; same for both SEQRES and ATOM records:

>d1ikia_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., R61 [TaxId: 1931]}
lpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrvgs
vtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmfaq
tvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsvate
yqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagavis
stqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtgtv
qgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp

Timeline for d1ikia_:

• d1ikia_ first appeared in SCOP 1.63
  
• d1ikia_ appears in SCOPe 2.07