Lineage for d1iika_ (1iik A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 223936Fold b.3: Prealbumin-like [49451] (6 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 224019Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family) (S)
  5. 224020Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)
  6. 224021Protein Transthyretin (synonym: prealbumin) [49474] (3 species)
    sandwich; 8 strands in 2 sheets
  7. 224025Species Human (Homo sapiens) [TaxId:9606] [49475] (44 PDB entries)
  8. 224082Domain d1iika_: 1iik A: [76746]

Details for d1iika_

PDB Entry: 1iik (more details), 2 Å

PDB Description: crystal structure of the transthyretin mutant ttr y114c-data collected at cryo temperature

SCOP Domain Sequences for d1iika_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iika_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspcsysttavvtnp

SCOP Domain Coordinates for d1iika_:

Click to download the PDB-style file with coordinates for d1iika_.
(The format of our PDB-style files is described here.)

Timeline for d1iika_: