Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein Hepatocyte nuclear factor 1a (LFB1/HNF1) [46697] (2 species) atypical Homeodomain with a large insertion into HTH motif |
Species Human (Homo sapiens) [TaxId:9606] [81680] (1 PDB entry) |
Domain d1ic8b1: 1ic8 B:201-278 [76742] Other proteins in same PDB: d1ic8a2, d1ic8b2 protein/DNA complex has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1ic8 (more details), 2.6 Å
SCOPe Domain Sequences for d1ic8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ic8b1 a.4.1.1 (B:201-278) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Human (Homo sapiens) [TaxId: 9606]} rnrfkwgpasqqilfqayerqknpskeeretlveecnraeciqrgvspsqaqglgsnlvt evrvynwfanrrkeeafr
Timeline for d1ic8b1: