SCOPe 2.08: Domain d1ic8b1: 1ic8 B:201-278

Lineage for d1ic8b1 (1ic8 B:201-278)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein Hepatocyte nuclear factor 1a (LFB1/HNF1) [46697] (2 species)
   atypical Homeodomain with a large insertion into HTH motif

7. Species Human (Homo sapiens) [TaxId:9606] [81680] (1 PDB entry)

8. Domain d1ic8b1: 1ic8 B:201-278 [76742]
   Other proteins in same PDB: d1ic8a2, d1ic8b2
   protein/DNA complex
   has additional insertions and/or extensions that are not grouped together

Details for d1ic8b1

PDB Entry: 1ic8, 2.6 Å

PDB Description: hepatocyte nuclear factor 1a bound to dna : mody3 gene product

PDB Compounds: (B:) hepatocyte nuclear factor 1-alpha

SCOPe Domain Sequences for d1ic8b1:

Sequence; same for both SEQRES and ATOM records:

>d1ic8b1 a.4.1.1 (B:201-278) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Human (Homo sapiens) [TaxId: 9606]}
rnrfkwgpasqqilfqayerqknpskeeretlveecnraeciqrgvspsqaqglgsnlvt
evrvynwfanrrkeeafr

Timeline for d1ic8b1:

• d1ic8b1 first appeared in SCOP 1.63
  
• d1ic8b1 appears in SCOPe 2.07