Lineage for d1ia7a_ (1ia7 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742882Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1742883Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 1742900Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)
  6. 1742955Protein Nonprocessive cellulase Cel9M [81846] (1 species)
    contains only the catalytic module, which interacts with the substrate
  7. 1742956Species Clostridium cellulolyticum [TaxId:1521] [81847] (2 PDB entries)
  8. 1742958Domain d1ia7a_: 1ia7 A: [76739]
    complex with cellobiose
    complexed with ca, edo, ni, so4, zn

Details for d1ia7a_

PDB Entry: 1ia7 (more details), 2 Å

PDB Description: crystal structure of the cellulase cel9m of c. cellulolyticium in complex with cellobiose
PDB Compounds: (A:) cellulase cel9m

SCOPe Domain Sequences for d1ia7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ia7a_ a.102.1.2 (A:) Nonprocessive cellulase Cel9M {Clostridium cellulolyticum [TaxId: 1521]}
agthdystalkdsiiffdankcgpqagennvfdwrgachttdgsdvgvdltggyhdagdh
vkfglpqgysaailgwslyefkesfdatgnttkmlqqlkyftdyflkshpnsttfyyqvg
egnadhtywgapeeqtgqrpslykadpsspasdilsetsaaltlmylnyknidsayatkc
lnaakelyamgkanqgvgngqsfyqatsfgddlawaatwlytatndstyitdaeqfitlg
ntmnenkmqdkwtmcwddmyvpaalrlaqitgkqiykdaiefnfnywktqvtttpgglkw
lsnwgvlryaaaesmvmlvyckqnpdqslldlakkqvdyilgdnpanmsyiigygsnwci
hphhraangytyangdnakpakhlltgalvggpdqndkflddanqyqytevaldynaglv
gvlagaikffg

SCOPe Domain Coordinates for d1ia7a_:

Click to download the PDB-style file with coordinates for d1ia7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ia7a_: