Lineage for d1i4ja_ (1i4j A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256982Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 256983Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 256984Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 256985Protein Ribosomal protein L22 [54845] (2 species)
  7. 256995Species Thermus aquaticus, subsp. Thermus thermophilus [TaxId:271] [54846] (2 PDB entries)
  8. 256996Domain d1i4ja_: 1i4j A: [76734]

Details for d1i4ja_

PDB Entry: 1i4j (more details), 1.8 Å

PDB Description: crystal structure of l22 ribosomal protein mutant

SCOP Domain Sequences for d1i4ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4ja_ d.55.1.1 (A:) Ribosomal protein L22 {Thermus aquaticus, subsp. Thermus thermophilus}
meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
nhdaledrlyvkaayvdegpavlprargradiikkrtshitvilgekhgk

SCOP Domain Coordinates for d1i4ja_:

Click to download the PDB-style file with coordinates for d1i4ja_.
(The format of our PDB-style files is described here.)

Timeline for d1i4ja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i4jb_