Lineage for d1i1xa_ (1i1x A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 384721Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 385002Protein Xylanase A, catalytic core [51514] (7 species)
  7. 385061Species Thermoascus aurantiacus [TaxId:5087] [51518] (9 PDB entries)
  8. 385063Domain d1i1xa_: 1i1x A: [76733]
    complexed with pca

Details for d1i1xa_

PDB Entry: 1i1x (more details), 1.11 Å

PDB Description: 1.11 a atomic resolution structure of a thermostable xylanase from thermoascus aurantiacus

SCOP Domain Sequences for d1i1xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1xa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus}
eaaqsvdqlikargkvyfgvatdqnrlttgknaaiiqanfgqvtpensmkwdatepsqgn
fnfagadylvnwaqqngklirghtlvwhsqlpswvssitdkntltnvmknhittlmtryk
gkirawdvvneafnedgslrqtvflnvigedyipiafqtaraadpnaklyindynldsas
ypktqaivnrvkkwraagvpidgigsqthlsagqgasvlqalpllasagtpevaiteldv
agasstdyvnvvnaclnvsscvgitvwgvadpdswrasttpllfdgnfnpkpaynaivqn
lq

SCOP Domain Coordinates for d1i1xa_:

Click to download the PDB-style file with coordinates for d1i1xa_.
(The format of our PDB-style files is described here.)

Timeline for d1i1xa_: