Lineage for d1i1wa_ (1i1w A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 815744Family c.1.8.3: beta-glycanases [51487] (26 proteins)
    consist of a number of sequence families
  6. 816176Protein Xylanase A, catalytic core [51514] (8 species)
  7. 816251Species Thermoascus aurantiacus [TaxId:5087] [51518] (10 PDB entries)
  8. 816252Domain d1i1wa_: 1i1w A: [76732]
    ultra high resolution structure
    complexed with acn, eoh, gol, pca, unx

Details for d1i1wa_

PDB Entry: 1i1w (more details), 0.89 Å

PDB Description: 0.89a ultra high resolution structure of a thermostable xylanase from thermoascus aurantiacus
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOP Domain Sequences for d1i1wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1wa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus [TaxId: 5087]}
eaaqsvdqlikargkvyfgvatdqnrlttgknaaiiqanfgqvtpensmkwdatepsqgn
fnfagadylvnwaqqngklirghtlvwhsqlpswvssitdkntltnvmknhittlmtryk
gkirawdvvneafnedgslrqtvflnvigedyipiafqtaraadpnaklyindynldsas
ypktqaivnrvkkwraagvpidgigsqthlsagqgasvlqalpllasagtpevaiteldv
agasstdyvnvvnaclnvsscvgitvwgvadpdswrasttpllfdgnfnpkpaynaivqn
lqq

SCOP Domain Coordinates for d1i1wa_:

Click to download the PDB-style file with coordinates for d1i1wa_.
(The format of our PDB-style files is described here.)

Timeline for d1i1wa_: