Lineage for d1hzfa_ (1hzf A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004426Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2004699Family a.102.4.4: Complement components [48251] (4 protein domains)
    probably related to other families, but has no known enzymatic activity
  6. 2004700Protein C4adg fragment of complement factor C4a [81859] (1 species)
  7. 2004701Species Human (Homo sapiens) [TaxId:9606] [81860] (1 PDB entry)
  8. 2004702Domain d1hzfa_: 1hzf A: [76731]

Details for d1hzfa_

PDB Entry: 1hzf (more details), 2.3 Å

PDB Description: c4adg fragment of human complement factor c4a
PDB Compounds: (A:) complement factor c4a

SCOPe Domain Sequences for d1hzfa_:

Sequence, based on SEQRES records: (download)

>d1hzfa_ a.102.4.4 (A:) C4adg fragment of complement factor C4a {Human (Homo sapiens) [TaxId: 9606]}
spggvasllrlprgcgeqtmiylaptlaasryldkteqwstlppetkdhavdliqkgymr
iqqfrkadgsyaawlsrdsstwltafvlkvlslaqeqvggspeklqetsnwllsqqqadg
sfqdpcpvldrsmqgglvgndetvaltafvtialhhglavfqdegaeplkqrveasiska
ssflgekasagllgahaaaitayaltltkapadlrgvahnnlmamaqetgdnlywgsvtg
sqsnavsptpaprnpsdpmpqapalwiettayallhlllhegkaemadqasawltrqgsf
qggfrstqdtvialdalsaywiasht

Sequence, based on observed residues (ATOM records): (download)

>d1hzfa_ a.102.4.4 (A:) C4adg fragment of complement factor C4a {Human (Homo sapiens) [TaxId: 9606]}
spggvasllrlprgcgeqtmiylaptlaasryldkteqwstlppetkdhavdliqkgymr
iqqfrkadgsyaawlsrdsstwltafvlkvlslaqeqvggspeklqetsnwllsqqqadg
sfqdpcpvldrsmqgglvgndetvaltafvtialhhglavfqdegaeplkqrveasiska
ssflgekasagllgahaaaitayaltltkapadlrgvahnnlmamaqetgdnlywgqapa
lwiettayallhlllhegkaemadqasawltrqgsfqggfrstqdtvialdalsaywias
ht

SCOPe Domain Coordinates for d1hzfa_:

Click to download the PDB-style file with coordinates for d1hzfa_.
(The format of our PDB-style files is described here.)

Timeline for d1hzfa_: