Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) |
Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins) |
Protein Plant beta-glucosidase (myrosinase) [51522] (3 species) |
Species Maize (Zea mays), zmglu1 [TaxId:4577] [51525] (8 PDB entries) |
Domain d1hxja_: 1hxj A: [76729] |
PDB Entry: 1hxj (more details), 2.05 Å
SCOP Domain Sequences for d1hxja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hxja_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Maize (Zea mays), zmglu1} qmlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnhperildgsns digansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgikyyrnlinlll engiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfgdkvknwltfn epqtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahaeavdlynkhyk rddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypfsmrslarerl pffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasqevngpdgkpi gppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplpmeaalndykr ldyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdrnnnctrymke sakwlkefnt
Timeline for d1hxja_: