Lineage for d1hxhb_ (1hxh B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2841584Protein 3beta/17beta hydroxysteroid dehydrogenase [82290] (1 species)
  7. 2841585Species Comamonas testosteroni [TaxId:285] [82291] (1 PDB entry)
  8. 2841587Domain d1hxhb_: 1hxh B: [76726]

Details for d1hxhb_

PDB Entry: 1hxh (more details), 1.22 Å

PDB Description: comamonas testosteroni 3beta/17beta hydroxysteroid dehydrogenase
PDB Compounds: (B:) 3beta/17beta-hydroxysteroid dehydrogenase

SCOPe Domain Sequences for d1hxhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxhb_ c.2.1.2 (B:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]}
tnrlqgkvalvtggasgvglevvklllgegakvafsdineaagqqlaaelgersmfvrhd
vsseadwtlvmaavqrrlgtlnvlvnnagillpgdmetgrledfsrllkintesvfigcq
qgiaamketggsiinmasvsswlpieqyagysaskaavsaltraaalscrkqgyairvns
ihpdgiytpmmqaslpkgvskemvlhdpklnragraymperiaqlvlflasdessvmsgs
elhadnsilgmgl

SCOPe Domain Coordinates for d1hxhb_:

Click to download the PDB-style file with coordinates for d1hxhb_.
(The format of our PDB-style files is described here.)

Timeline for d1hxhb_: