Lineage for d1hu0a2 (1hu0 A:9-135)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 262082Fold d.129: TBP-like [55944] (4 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 262083Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 262176Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (2 proteins)
    contains a single copy of this fold
  6. 262183Protein 8-oxoguanine glycosylase [55955] (1 species)
  7. 262184Species Human (Homo sapiens) [TaxId:9606] [55956] (7 PDB entries)
  8. 262189Domain d1hu0a2: 1hu0 A:9-135 [76724]
    Other proteins in same PDB: d1hu0a1
    borohydride trapped intermediate complex
    complexed with ca, oxg, ped

Details for d1hu0a2

PDB Entry: 1hu0 (more details), 2.35 Å

PDB Description: crystal structure of an hogg1-dna borohydride trapped intermediate complex

SCOP Domain Sequences for d1hu0a2:

Sequence, based on SEQRES records: (download)

>d1hu0a2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens)}
gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
teeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfq
gvrllrq

Sequence, based on observed residues (ATOM records): (download)

>d1hu0a2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens)}
gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq

SCOP Domain Coordinates for d1hu0a2:

Click to download the PDB-style file with coordinates for d1hu0a2.
(The format of our PDB-style files is described here.)

Timeline for d1hu0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hu0a1