SCOPe 2.08: Domain d1hu0a2: 1hu0 A:12-135

Lineage for d1hu0a2 (1hu0 A:12-135)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (3 proteins)
   contains a single copy of this fold

6. Protein 8-oxoguanine glycosylase [55955] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55956] (24 PDB entries)

8. Domain d1hu0a2: 1hu0 A:12-135 [76724]
   Other proteins in same PDB: d1hu0a1, d1hu0a3
   borohydride trapped intermediate complex
   protein/DNA complex; complexed with ca, oxg

Details for d1hu0a2

PDB Entry: 1hu0, 2.35 Å

PDB Description: crystal structure of an hogg1-dna borohydride trapped intermediate complex

PDB Compounds: (A:) 8-oxoguanine DNA glycosylase 1

SCOPe Domain Sequences for d1hu0a2:

Sequence, based on SEQRES records:

>d1hu0a2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq

Sequence, based on observed residues (ATOM records):

>d1hu0a2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvrllr
q

Timeline for d1hu0a2:

• d1hu0a2 first appeared in SCOP 1.63
  
• d1hu0a2 appears in SCOPe 2.07