Lineage for d1hm7b_ (1hm7 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731747Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 proteins)
  6. 2731754Protein Pentalenene synthase [48589] (1 species)
  7. 2731755Species Streptomyces sp., UC5319 [TaxId:1931] [48590] (11 PDB entries)
  8. 2731775Domain d1hm7b_: 1hm7 B: [76720]

Details for d1hm7b_

PDB Entry: 1hm7 (more details), 2.9 Å

PDB Description: n219l pentalenene synthase
PDB Compounds: (B:) pentalenene synthase

SCOPe Domain Sequences for d1hm7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hm7b_ a.128.1.4 (B:) Pentalenene synthase {Streptomyces sp., UC5319 [TaxId: 1931]}
fhiplpgrqspdharaeaeqlawprslglirsdaaaerhlrggyadlasrfyphatgadl
dlgvdlmswfflfddlfdgprgenpedtkqltdqvaaaldgplpdtappiahgfadiwrr
tcegmtpawcarsarhwrnyfdgyvdeaesrfwnapcdsaaqylamrrhtigvqptvdla
eragrfevphrvfdsavmsamlqiavdvnlllldiaslekeeargeqnnmvmilrrehgw
sksrsvshmqnevrarleqylllesclpkvgeiyqldtaerealeryrtdavrtvirgsy
dwhrs

SCOPe Domain Coordinates for d1hm7b_:

Click to download the PDB-style file with coordinates for d1hm7b_.
(The format of our PDB-style files is described here.)

Timeline for d1hm7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hm7a_