Lineage for d1hm4b_ (1hm4 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010800Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 protein domains)
  6. 2010807Protein Pentalenene synthase [48589] (1 species)
  7. 2010808Species Streptomyces sp., UC5319 [TaxId:1931] [48590] (3 PDB entries)
  8. 2010814Domain d1hm4b_: 1hm4 B: [76716]

Details for d1hm4b_

PDB Entry: 1hm4 (more details), 3.47 Å

PDB Description: n219l pentalenene synthase
PDB Compounds: (B:) pentalenene synthase

SCOPe Domain Sequences for d1hm4b_:

Sequence, based on SEQRES records: (download)

>d1hm4b_ a.128.1.4 (B:) Pentalenene synthase {Streptomyces sp., UC5319 [TaxId: 1931]}
iplpgrqspdharaeaeqlawprslglirsdaaaerhlrggyadlasrfyphatgadldl
gvdlmswfflfddlfdgprgenpedtkqltdqvaaaldgplpdtappiahgfadiwrrtc
egmtpawcarsarhwrnyfdgyvdeaesrfwnapcdsaaqylamrrhtigvqptvdlaer
agrfevphrvfdsavmsamlqiavdvnlllldiaslekeeargeqnnmvmilrrehgwsk
srsvshmqnevrarleqylllesclpkvgeiyqldtaerealeryrtdavrtvirgsydw
h

Sequence, based on observed residues (ATOM records): (download)

>d1hm4b_ a.128.1.4 (B:) Pentalenene synthase {Streptomyces sp., UC5319 [TaxId: 1931]}
iplpgrqspdharaeaeqlawprslglirsdaaaerhlrggyadlasrfyphatgadldl
gvdlmswfflfddlfdgprgenpedtkqltdqvaaaldgplpdtappiahgfadiwrrtc
egmtpawcarsarhwrnyfdgyvdeaesrfwnpcdsaaqylamrrhtigvqptvdlaera
grfevphrvfdsavmsamlqiavdvnlllldiaslekeeargeqnnmvmilrrehgwsks
rsvshmqnevrarleqylllesclpkvgeiyqldtaerealeryrtdavrtvirgsydwh

SCOPe Domain Coordinates for d1hm4b_:

Click to download the PDB-style file with coordinates for d1hm4b_.
(The format of our PDB-style files is described here.)

Timeline for d1hm4b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hm4a_