Lineage for d1hm4a_ (1hm4 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 360883Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 360884Superfamily a.128.1: Terpenoid synthases [48576] (5 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 360941Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (2 proteins)
  6. 360948Protein Pentalenene synthase [48589] (1 species)
  7. 360949Species Streptomyces sp., UC5319 [TaxId:1931] [48590] (3 PDB entries)
  8. 360954Domain d1hm4a_: 1hm4 A: [76715]

Details for d1hm4a_

PDB Entry: 1hm4 (more details), 3.47 Å

PDB Description: n219l pentalenene synthase

SCOP Domain Sequences for d1hm4a_:

Sequence, based on SEQRES records: (download)

>d1hm4a_ a.128.1.4 (A:) Pentalenene synthase {Streptomyces sp., UC5319}
vdfhiplpgrqspdharaeaeqlawprslglirsdaaaerhlrggyadlasrfyphatga
dldlgvdlmswfflfddlfdgprgenpedtkqltdqvaaaldgplpdtappiahgfadiw
rrtcegmtpawcarsarhwrnyfdgyvdeaesrfwnapcdsaaqylamrrhtigvqptvd
laeragrfevphrvfdsavmsamlqiavdvnlllldiaslekeeargeqnnmvmilrreh
gwsksrsvshmqnevrarleqylllesclpkvgeiyqldtaerealeryrtdavrtvirg
sydwhrs

Sequence, based on observed residues (ATOM records): (download)

>d1hm4a_ a.128.1.4 (A:) Pentalenene synthase {Streptomyces sp., UC5319}
vdfhiplpgrqspdharaeaeqlawprslglirsdaaaerhlrggyadlasrfyphatga
dldlgvdlmswfflfddlfdgprgenpedtkqltdqvaaaldgplpdtappiahgfadiw
rrtcegmtpawcarsarhwrnyfdgyvdeaesraaqylamrrhtigvqptvdlaeragrf
evphrvfdsavmsamlqiavdvnlllldiaslekeeargeqnnmvmsrsvshmqnevrar
leqylllesclpkvgeiyqldtaerealeryrtdavrtvirgsydwhrs

SCOP Domain Coordinates for d1hm4a_:

Click to download the PDB-style file with coordinates for d1hm4a_.
(The format of our PDB-style files is described here.)

Timeline for d1hm4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hm4b_