Lineage for d1hkya1 (1hky A:9-86)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259916Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
    alpha+beta fold with two crossing loops
  4. 2259917Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) (S)
    the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern
  5. 2259992Family g.10.1.3: Pan module (APPLE domain) [82901] (1 protein)
    probable carbohydrate-binding function
  6. 2259993Protein Pan module from microneme protein 5 (MIC-5) [82902] (1 species)
  7. 2259994Species Eimeria tenella [TaxId:5802] [82903] (1 PDB entry)
  8. 2259995Domain d1hkya1: 1hky A:9-86 [76714]
    Other proteins in same PDB: d1hkya2

Details for d1hkya1

PDB Entry: 1hky (more details)

PDB Description: solution structure of a pan module from eimeria tenella
PDB Compounds: (A:) microneme protein 5 precursor

SCOPe Domain Sequences for d1hkya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkya1 g.10.1.3 (A:9-86) Pan module from microneme protein 5 (MIC-5) {Eimeria tenella [TaxId: 5802]}
vkltcyqngvsftggkaiseakaassqacqelcekdakcrfftlasgkcslfaddaalrp
tksdgavsgnkrcilled

SCOPe Domain Coordinates for d1hkya1:

Click to download the PDB-style file with coordinates for d1hkya1.
(The format of our PDB-style files is described here.)

Timeline for d1hkya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hkya2