Lineage for d1hkya_ (1hky A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890808Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
    alpha+beta fold with two crossing loops
  4. 890809Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) (S)
    the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern
  5. 890840Family g.10.1.3: Pan module (APPLE domain) [82901] (1 protein)
    probable carbohydrate-binding function
  6. 890841Protein Pan module from microneme protein 5 (MIC-5) [82902] (1 species)
  7. 890842Species Eimeria tenella [TaxId:5802] [82903] (1 PDB entry)
  8. 890843Domain d1hkya_: 1hky A: [76714]

Details for d1hkya_

PDB Entry: 1hky (more details)

PDB Description: solution structure of a pan module from eimeria tenella
PDB Compounds: (A:) microneme protein 5 precursor

SCOP Domain Sequences for d1hkya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkya_ g.10.1.3 (A:) Pan module from microneme protein 5 (MIC-5) {Eimeria tenella [TaxId: 5802]}
dykddddkvkltcyqngvsftggkaiseakaassqacqelcekdakcrfftlasgkcslf
addaalrptksdgavsgnkrcilled

SCOP Domain Coordinates for d1hkya_:

Click to download the PDB-style file with coordinates for d1hkya_.
(The format of our PDB-style files is described here.)

Timeline for d1hkya_: