Lineage for d1hkya_ (1hky A:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 270106Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
    alpha+beta fold with two crossing loops
  4. 270107Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) (S)
    the middle part is structurally similar to some knottins and defensins but differs in the disulphide pattern
  5. 270136Family g.10.1.3: Pan module (APPLE domain) [82901] (1 protein)
    probable carbohydrate-binding function
  6. 270137Protein Pan module from microneme protein 5 (MIC-5) [82902] (1 species)
  7. 270138Species Eimeria tenella [82903] (1 PDB entry)
  8. 270139Domain d1hkya_: 1hky A: [76714]

Details for d1hkya_

PDB Entry: 1hky (more details)

PDB Description: solution structure of a pan module from eimeria tenella

SCOP Domain Sequences for d1hkya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkya_ g.10.1.3 (A:) Pan module from microneme protein 5 (MIC-5) {Eimeria tenella}
dykddddkvkltcyqngvsftggkaiseakaassqacqelcekdakcrfftlasgkcslf
addaalrptksdgavsgnkrcilled

SCOP Domain Coordinates for d1hkya_:

Click to download the PDB-style file with coordinates for d1hkya_.
(The format of our PDB-style files is described here.)

Timeline for d1hkya_: