Lineage for d1hfbf_ (1hfb F:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683918Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 684412Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 684413Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (3 species)
  7. 684414Species Baker's yeast (Saccharomyces cerevisiae), tyrosine-regulated isozyme [TaxId:4932] [82272] (11 PDB entries)
  8. 684430Domain d1hfbf_: 1hfb F: [76711]

Details for d1hfbf_

PDB Entry: 1hfb (more details), 1.9 Å

PDB Description: crystal structure of the tyrosine-regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase from saccharomyces cerevisiae complexed with phosphoenolpyruvate
PDB Compounds: (F:) tyrosine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase

SCOP Domain Sequences for d1hfbf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfbf_ c.1.10.4 (F:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Baker's yeast (Saccharomyces cerevisiae), tyrosine-regulated isozyme [TaxId: 4932]}
vrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihdle
aaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqsar
qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
nqgipaegkaglkygvsitdacigwettedvlrklaaavrqrrevn

SCOP Domain Coordinates for d1hfbf_:

Click to download the PDB-style file with coordinates for d1hfbf_.
(The format of our PDB-style files is described here.)

Timeline for d1hfbf_: