Lineage for d1h44a_ (1h44 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2914985Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 2914986Protein Lactoferrin [53889] (6 species)
  7. 2915041Species Human (Homo sapiens) [TaxId:9606] [53890] (21 PDB entries)
  8. 2915043Domain d1h44a_: 1h44 A: [76673]
    N-terminal lobe
    complexed with co3, fe

Details for d1h44a_

PDB Entry: 1h44 (more details), 2 Å

PDB Description: r210l n-terminal lobe human lactoferrin
PDB Compounds: (A:) lactoferrin

SCOPe Domain Sequences for d1h44a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h44a_ c.94.1.2 (A:) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]}
rsvqwcavsqpeatkcfqwqrnmrkvrgppvscikrdspiqciqaiaenradavtldggf
iyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglrrta
gwnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenkcaf
ssqepyfsysgafkclrdgagdvafilestvfedlsdeaerdeyellcpdntrkpvdkfk
dchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdllfkds
aigfsrvppridsglylgsgyft

SCOPe Domain Coordinates for d1h44a_:

Click to download the PDB-style file with coordinates for d1h44a_.
(The format of our PDB-style files is described here.)

Timeline for d1h44a_: