| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88590] (26 PDB entries) |
| Domain d1h3yb2: 1h3y B:342-443 [76670] Other proteins in same PDB: d1h3ya1, d1h3yb1 part of a Fc complexed with afl, bma, gla, man, nag, ndg |
PDB Entry: 1h3y (more details), 4.1 Å
SCOP Domain Sequences for d1h3yb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h3yb2 b.1.1.2 (B:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl
Timeline for d1h3yb2: