SCOP 1.73: Domain d1h3ub1: 1h3u B:238-341

Lineage for d1h3ub1 (1h3u B:238-341)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (25 PDB entries)

8. Domain d1h3ub1: 1h3u B:238-341 [76659]
   Other proteins in same PDB: d1h3ua2, d1h3ub2
   part of a Fc
   complexed with afl, bma, man, nag

Details for d1h3ub1

PDB Entry: 1h3u, 2.4 Å

PDB Description: crystal structure of the human igg1 fc-fragment,glycoform (m3n2f)2

PDB Compounds: (B:) Ig gamma-1 chain C region

SCOP Domain Sequences for d1h3ub1:

Sequence; same for both SEQRES and ATOM records:

>d1h3ub1 b.1.1.2 (B:238-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

Timeline for d1h3ub1:

• d1h3ub1 first appeared in SCOP 1.63
  
• d1h3ub1 appears in SCOP 1.71
  
• d1h3ub1 appears in SCOP 1.75
  
• d1h3ub1 appears in the current release, SCOPe 2.08