Lineage for d1h3qa_ (1h3q A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 261219Fold d.110: Profilin-like [55769] (5 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 261330Superfamily d.110.4: SNARE-like [64356] (3 families) (S)
    beta(2)-alpha-beta(3)-alpha(2)
  5. 261346Family d.110.4.3: Sedlin (SEDL) [82767] (1 protein)
  6. 261347Protein Sedlin (SEDL) [82768] (1 species)
  7. 261348Species Mouse (Mus musculus) [TaxId:10090] [82769] (1 PDB entry)
  8. 261349Domain d1h3qa_: 1h3q A: [76652]

Details for d1h3qa_

PDB Entry: 1h3q (more details), 2.4 Å

PDB Description: crystal sturcture of sedl at 2.4 angstroms resolution

SCOP Domain Sequences for d1h3qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3qa_ d.110.4.3 (A:) Sedlin (SEDL) {Mouse (Mus musculus)}
msgsfyfvivghhdnpvfemeflppgkaeskddhrhlnqfiahaaldlvdenmwlsnnmy
lktvdkfnewfvsafvtaghmrfimlhdvrqedgiknfftdvydlyikfamnpfyepnsp
irssafdrkvqflgkkhlls

SCOP Domain Coordinates for d1h3qa_:

Click to download the PDB-style file with coordinates for d1h3qa_.
(The format of our PDB-style files is described here.)

Timeline for d1h3qa_: