SCOP 1.63: Domain d1h3pl1: 1h3p L:1-107

Lineage for d1h3pl1 (1h3p L:1-107)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Anti-hepatitis B Fab, (mouse), kappa L chain [81945] (1 PDB entry)
   against PRES1 region

8. Domain d1h3pl1: 1h3p L:1-107 [76650]
   Other proteins in same PDB: d1h3ph2, d1h3pl2

Details for d1h3pl1

PDB Entry: 1h3p, 2.6 Å

PDB Description: structural characterisation of a monoclonal antibody specific for the pres1 region of the hepatitis b virus

SCOP Domain Sequences for d1h3pl1:

Sequence; same for both SEQRES and ATOM records:

>d1h3pl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-hepatitis B Fab, (mouse), kappa L chain}
divmtqspsslavsvgekvtmscrssqsllntrtrksylawfqqkpgqspkmliywastr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsyslytfgggtkleik

Timeline for d1h3pl1:

• d1h3pl1 is new in SCOP 1.63
  
• d1h3pl1 appears in SCOP 1.65
  
• d1h3pl1 appears in the current release, SCOPe 2.08