Lineage for d1h3pl1 (1h3p L:1-107)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 protein domains)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219079Species Anti-hepatitis B Fab, (mouse), kappa L chain [81945] (1 PDB entry)
    against PRES1 region
  8. 219081Domain d1h3pl1: 1h3p L:1-107 [76650]
    Other proteins in same PDB: d1h3ph2, d1h3pl2

Details for d1h3pl1

PDB Entry: 1h3p (more details), 2.6 Å

PDB Description: structural characterisation of a monoclonal antibody specific for the pres1 region of the hepatitis b virus

SCOP Domain Sequences for d1h3pl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3pl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-hepatitis B Fab, (mouse), kappa L chain}
divmtqspsslavsvgekvtmscrssqsllntrtrksylawfqqkpgqspkmliywastr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsyslytfgggtkleik

SCOP Domain Coordinates for d1h3pl1:

Click to download the PDB-style file with coordinates for d1h3pl1.
(The format of our PDB-style files is described here.)

Timeline for d1h3pl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h3pl2