Lineage for d1h3ph1 (1h3p H:1-113)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451105Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (49 PDB entries)
  8. 451144Domain d1h3ph1: 1h3p H:1-113 [76648]
    Other proteins in same PDB: d1h3ph2, d1h3pl1, d1h3pl2
    part of anti-hepatitis B Fab (against PRES1 region)

Details for d1h3ph1

PDB Entry: 1h3p (more details), 2.6 Å

PDB Description: structural characterisation of a monoclonal antibody specific for the pres1 region of the hepatitis b virus

SCOP Domain Sequences for d1h3ph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3ph1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2}
evqlvesggglvkpggslklscaasgftfssyamswvrqspekrlewvaevssdgsyayy
pdtltgrftisrdnakntlylemtslrsedtamyycasfnwdvaywgqgtlvtvsa

SCOP Domain Coordinates for d1h3ph1:

Click to download the PDB-style file with coordinates for d1h3ph1.
(The format of our PDB-style files is described here.)

Timeline for d1h3ph1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h3ph2