Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins) |
Protein TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain [81722] (1 species) forms a heterodimer with TAF(II)-135 similar to H2A-H2B |
Species Human (Homo sapiens) [TaxId:9606] [81723] (1 PDB entry) |
Domain d1h3od1: 1h3o D:57-128 [76647] Other proteins in same PDB: d1h3oa_, d1h3ob2, d1h3oc_, d1h3od2 protein/RNA complex |
PDB Entry: 1h3o (more details), 2.3 Å
SCOPe Domain Sequences for d1h3od1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h3od1 a.22.1.3 (D:57-128) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} vltkkklqdlvrevdpneqldedveemllqiaddfiesvvtaacqlarhrksstlevkdv qlhlerqwnmwi
Timeline for d1h3od1:
View in 3D Domains from other chains: (mouse over for more information) d1h3oa_, d1h3ob1, d1h3ob2, d1h3oc_ |