SCOP 1.65: Domain d1h3od_: 1h3o D:

Lineage for d1h3od_ (1h3o D:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.3: TBP-associated factors, TAFs [47134] (10 proteins)

6. Protein TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain [81722] (1 species)
   forms a heterodimer with TAF(II)-135 similar to H2A-H2B

7. Species Human (Homo sapiens) [TaxId:9606] [81723] (1 PDB entry)

8. Domain d1h3od_: 1h3o D: [76647]
   Other proteins in same PDB: d1h3oa_, d1h3oc_
   complexed with mse; mutant

Details for d1h3od_

PDB Entry: 1h3o, 2.3 Å

PDB Description: crystal structure of the human taf4-taf12 (tafii135-tafii20) complex

SCOP Domain Sequences for d1h3od_:

Sequence; same for both SEQRES and ATOM records:

>d1h3od_ a.22.1.3 (D:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens)}
hmvltkkklqdlvrevdpneqldedveemllqiaddfiesvvtaacqlarhrksstlevk
dvqlhlerqwnmwi

Timeline for d1h3od_:

• d1h3od_ first appeared in SCOP 1.63
  
• d1h3od_ appears in SCOP 1.67
  
• d1h3od_ appears in the current release, SCOPe 2.08, called d1h3od1