Lineage for d1h3od_ (1h3o D:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 211635Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 211636Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 211765Family a.22.1.3: TBP-associated factors, TAFs [47134] (10 proteins)
  6. 211782Protein TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain [81722] (1 species)
    forms a heterodimer with TAF(II)-135 similar to H2A-H2B
  7. 211783Species Human (Homo sapiens) [TaxId:9606] [81723] (1 PDB entry)
  8. 211785Domain d1h3od_: 1h3o D: [76647]
    Other proteins in same PDB: d1h3oa_, d1h3oc_
    complexed with mse; mutant

Details for d1h3od_

PDB Entry: 1h3o (more details), 2.3 Å

PDB Description: crystal structure of the human taf4-taf12 (tafii135-tafii20) complex

SCOP Domain Sequences for d1h3od_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3od_ a.22.1.3 (D:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens)}
hmvltkkklqdlvrevdpneqldedveemllqiaddfiesvvtaacqlarhrksstlevk
dvqlhlerqwnmwi

SCOP Domain Coordinates for d1h3od_:

Click to download the PDB-style file with coordinates for d1h3od_.
(The format of our PDB-style files is described here.)

Timeline for d1h3od_: