| Class a: All alpha proteins [46456] (179 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (3 families) ![]() |
| Family a.22.1.3: TBP-associated factors, TAFs [47134] (10 proteins) |
| Protein TAF(II)-135, (TAF(II)-130, hTAF4), histone fold domain [81720] (1 species) lacks the third helix, forms a heterodimer with TAF(II)-20 similar to H2A-H2B |
| Species Human (Homo sapiens) [TaxId:9606] [81721] (1 PDB entry) |
| Domain d1h3oc_: 1h3o C: [76646] Other proteins in same PDB: d1h3ob_, d1h3od_ complexed with mse; mutant |
PDB Entry: 1h3o (more details), 2.3 Å
SCOP Domain Sequences for d1h3oc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h3oc_ a.22.1.3 (C:) TAF(II)-135, (TAF(II)-130, hTAF4), histone fold domain {Human (Homo sapiens)}
mfllqaplqrrileigkkhgitelhpdvvsyvshatqqrlqnlvekiset
Timeline for d1h3oc_: