SCOPe 2.07: Domain d1h3ob1: 1h3o B:57-128

Lineage for d1h3ob1 (1h3o B:57-128)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)

6. Protein TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain [81722] (1 species)
   forms a heterodimer with TAF(II)-135 similar to H2A-H2B

7. Species Human (Homo sapiens) [TaxId:9606] [81723] (1 PDB entry)

8. Domain d1h3ob1: 1h3o B:57-128 [76645]
   Other proteins in same PDB: d1h3oa_, d1h3ob2, d1h3oc_, d1h3od2
   protein/RNA complex

Details for d1h3ob1

PDB Entry: 1h3o, 2.3 Å

PDB Description: crystal structure of the human taf4-taf12 (tafii135-tafii20) complex

PDB Compounds: (B:) transcription initiation factor tfiid 20/15 kda subunits

SCOPe Domain Sequences for d1h3ob1:

Sequence; same for both SEQRES and ATOM records:

>d1h3ob1 a.22.1.3 (B:57-128) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]}
vltkkklqdlvrevdpneqldedveemllqiaddfiesvvtaacqlarhrksstlevkdv
qlhlerqwnmwi

Timeline for d1h3ob1:

• d1h3ob1 first appeared in SCOP 1.63, called d1h3ob_
  
• d1h3ob1 was called d1h3ob_ in SCOPe 2.06
  
• d1h3ob1 appears in the current release, SCOPe 2.08