![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (3 families) ![]() |
![]() | Family a.22.1.3: TBP-associated factors, TAFs [47134] (11 proteins) |
![]() | Protein TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain [81722] (1 species) forms a heterodimer with TAF(II)-135 similar to H2A-H2B |
![]() | Species Human (Homo sapiens) [TaxId:9606] [81723] (1 PDB entry) |
![]() | Domain d1h3ob_: 1h3o B: [76645] Other proteins in same PDB: d1h3oa_, d1h3oc_ |
PDB Entry: 1h3o (more details), 2.3 Å
SCOP Domain Sequences for d1h3ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens)} hmvltkkklqdlvrevdpneqldedveemllqiaddfiesvvtaacqlarhrksstlevk dvqlhlerqwnmwi
Timeline for d1h3ob_: