Lineage for d1h3ob1 (1h3o B:57-128)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310256Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2310257Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311035Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 protein domains)
  6. 2311075Protein TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain [81722] (1 species)
    forms a heterodimer with TAF(II)-135 similar to H2A-H2B
  7. 2311076Species Human (Homo sapiens) [TaxId:9606] [81723] (1 PDB entry)
  8. 2311077Domain d1h3ob1: 1h3o B:57-128 [76645]
    Other proteins in same PDB: d1h3oa_, d1h3ob2, d1h3oc_, d1h3od2
    protein/RNA complex

Details for d1h3ob1

PDB Entry: 1h3o (more details), 2.3 Å

PDB Description: crystal structure of the human taf4-taf12 (tafii135-tafii20) complex
PDB Compounds: (B:) transcription initiation factor tfiid 20/15 kda subunits

SCOPe Domain Sequences for d1h3ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3ob1 a.22.1.3 (B:57-128) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]}
vltkkklqdlvrevdpneqldedveemllqiaddfiesvvtaacqlarhrksstlevkdv
qlhlerqwnmwi

SCOPe Domain Coordinates for d1h3ob1:

Click to download the PDB-style file with coordinates for d1h3ob1.
(The format of our PDB-style files is described here.)

Timeline for d1h3ob1: