Lineage for d1h3oa_ (1h3o A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725671Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1725672Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1726284Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)
  6. 1726320Protein TAF(II)-135, (TAF(II)-130, hTAF4), histone fold domain [81720] (1 species)
    lacks the third helix, forms a heterodimer with TAF(II)-20 similar to H2A-H2B
  7. 1726321Species Human (Homo sapiens) [TaxId:9606] [81721] (1 PDB entry)
  8. 1726322Domain d1h3oa_: 1h3o A: [76644]
    Other proteins in same PDB: d1h3ob_, d1h3od_
    protein/RNA complex

Details for d1h3oa_

PDB Entry: 1h3o (more details), 2.3 Å

PDB Description: crystal structure of the human taf4-taf12 (tafii135-tafii20) complex
PDB Compounds: (A:) transcription initiation factor tfiid 135 kda subunit

SCOPe Domain Sequences for d1h3oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3oa_ a.22.1.3 (A:) TAF(II)-135, (TAF(II)-130, hTAF4), histone fold domain {Human (Homo sapiens) [TaxId: 9606]}
mfllqaplqrrileigkkhgitelhpdvvsyvshatqqrlqnlvekiset

SCOPe Domain Coordinates for d1h3oa_:

Click to download the PDB-style file with coordinates for d1h3oa_.
(The format of our PDB-style files is described here.)

Timeline for d1h3oa_: