![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins) |
![]() | Protein TAF(II)-135, (TAF(II)-130, hTAF4), histone fold domain [81720] (1 species) lacks the third helix, forms a heterodimer with TAF(II)-20 similar to H2A-H2B |
![]() | Species Human (Homo sapiens) [TaxId:9606] [81721] (1 PDB entry) |
![]() | Domain d1h3oa_: 1h3o A: [76644] Other proteins in same PDB: d1h3ob1, d1h3ob2, d1h3od1, d1h3od2 protein/RNA complex fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1h3o (more details), 2.3 Å
SCOPe Domain Sequences for d1h3oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h3oa_ a.22.1.3 (A:) TAF(II)-135, (TAF(II)-130, hTAF4), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} mfllqaplqrrileigkkhgitelhpdvvsyvshatqqrlqnlvekiset
Timeline for d1h3oa_: