Lineage for d1h3na3 (1h3n A:1-225,A:418-686)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2118898Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2118899Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2118973Protein Leucyl-tRNA synthetase (LeuRS) [82356] (1 species)
  7. 2118974Species Thermus thermophilus [TaxId:274] [82357] (3 PDB entries)
    contains a non-conserved insertion (residues 581-633) that forms a separate subdomain; possible rudiment Zn finger
  8. 2118975Domain d1h3na3: 1h3n A:1-225,A:418-686 [76643]
    Other proteins in same PDB: d1h3na1, d1h3na2
    protein/RNA complex; complexed with leu, lms, so4, zn

Details for d1h3na3

PDB Entry: 1h3n (more details), 2 Å

PDB Description: leucyl-trna synthetase from thermus thermophilus complexed with a sulphamoyl analogue of leucyl-adenylate
PDB Compounds: (A:) leucyl-tRNA synthetase

SCOPe Domain Sequences for d1h3na3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]}
mekynphaieakwqrfweekgfmkakdlpggrgkqyvlvmfpypsgdlhmghlknytmgd
vlarfrrmqgyevlhpmgwdafglpaenaalkfgvhpkdwtyanirqakeslrlmgilyd
wdrevttcepeyyrwnqwiflkmwekglayrakglvnwcpkcqtvlaneqvvegrcwrhe
dtpvekreleqwylritayaerllkdleglnwpekvkamqrawigXrlrdwlisrqrywg
tpipmvhceacgvvpvpeeelpvllpdlkdvedirpkgkspleahpefyettcpkcggpa
krdtdtmdtffdsswyylrytdphndrlpfdpekanawmpvdqyiggvehavlhllysrf
ftkflhdlgmvkveepfqglftqgmvlawtdfgpvevegsvvrlpeptrirleipesals
ledvrkmgaelrphedgtlhlwkpavmskskgngvmvgpfvkeqgadiaritilfaappe
nemvwteegvqgawr

SCOPe Domain Coordinates for d1h3na3:

Click to download the PDB-style file with coordinates for d1h3na3.
(The format of our PDB-style files is described here.)

Timeline for d1h3na3: