Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
Protein Leucyl-tRNA synthetase (LeuRS) [82356] (1 species) |
Species Thermus thermophilus [TaxId:274] [82357] (3 PDB entries) contains a non-conserved insertion (residues 581-633) that forms a separate subdomain; possible rudiment Zn finger |
Domain d1h3na3: 1h3n A:1-225,A:418-686 [76643] Other proteins in same PDB: d1h3na1, d1h3na2 protein/RNA complex; complexed with leu, lms, so4, zn |
PDB Entry: 1h3n (more details), 2 Å
SCOPe Domain Sequences for d1h3na3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} mekynphaieakwqrfweekgfmkakdlpggrgkqyvlvmfpypsgdlhmghlknytmgd vlarfrrmqgyevlhpmgwdafglpaenaalkfgvhpkdwtyanirqakeslrlmgilyd wdrevttcepeyyrwnqwiflkmwekglayrakglvnwcpkcqtvlaneqvvegrcwrhe dtpvekreleqwylritayaerllkdleglnwpekvkamqrawigXrlrdwlisrqrywg tpipmvhceacgvvpvpeeelpvllpdlkdvedirpkgkspleahpefyettcpkcggpa krdtdtmdtffdsswyylrytdphndrlpfdpekanawmpvdqyiggvehavlhllysrf ftkflhdlgmvkveepfqglftqgmvlawtdfgpvevegsvvrlpeptrirleipesals ledvrkmgaelrphedgtlhlwkpavmskskgngvmvgpfvkeqgadiaritilfaappe nemvwteegvqgawr
Timeline for d1h3na3: